Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens basic leucine zipper ATF-like transcription factor 3 (BATF3) (NM_018664). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NR55 |
| Entry Name | BATF3_HUMAN |
| Gene Names | BATF3 SNFT |
| Alternative Gene Names | SNFT |
| Alternative Protein Names | Basic leucine zipper transcriptional factor ATF-like 3 (B-ATF-3) (21 kDa small nuclear factor isolated from T-cells) (Jun dimerization protein p21SNFT) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 127 |
| Molecular Weight(Da) | 14468 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR |
Background
| Function | FUNCTION: AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity). Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. {ECO:0000250, ECO:0000269|PubMed:10878360, ECO:0000269|PubMed:12087103, ECO:0000269|PubMed:15467742}. |
| Pathway | |
| Protein Families | BZIP family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |