Recombinant Human ATPAF1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens ATP synthase mitochondrial F1 complex assembly factor 1 (ATPAF1), transcript variant 1 (NM_022745).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q5TC12
Entry Name ATPF1_HUMAN
Gene Names ATPAF1 ATP11
Alternative Gene Names ATP11
Alternative Protein Names ATP synthase mitochondrial F1 complex assembly factor 1 (ATP11 homolog)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 328
Molecular Weight(Da) 36437
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAVVVAAAGGAGPAVLQVAGLYRGLCAVRSRALGLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKIQLLRRSDPAAFESRLEKRSEFRKQPVGHSRQGDFIKCVEQKTDALGKQSVNRGFTKDKTLSSIFNIEMVKEKTAEEIKQIWQQYFAAKDTVYAVIPAEKFDLIWNRAQSCPTFLCALPRREGYEFFVGQWTGTELHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT
Background
Function FUNCTION: May play an essential role for the assembly of the mitochondrial F1-F0 complex. {ECO:0000250}.
Pathway
Protein Families ATP11 family
Tissue Specificity Weakly expressed in muscle. {ECO:0000269|PubMed:12965202}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8727646

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ATPAF1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.