Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens ATPase H+ transporting V1 subunit G3 (ATP6V1G3), transcript variant 2 (NM_133326). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q96LB4 |
Entry Name | VATG3_HUMAN |
Gene Names | ATP6V1G3 ATP6G3 |
Alternative Gene Names | ATP6G3 |
Alternative Protein Names | V-type proton ATPase subunit G 3 (V-ATPase subunit G 3) (V-ATPase 13 kDa subunit 3) (Vacuolar proton pump subunit G 3) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 118 |
Molecular Weight(Da) | 13917 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN |
Background
Function | FUNCTION: Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. |
Pathway | |
Protein Families | V-ATPase G subunit family |
Tissue Specificity | Kidney. {ECO:0000269|PubMed:12384298}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |