Recombinant Human AQP9 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens aquaporin 9 (AQP9), transcript variant 1 (NM_020980).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O43315
Entry Name AQP9_HUMAN
Gene Names AQP9 SSC1
Alternative Gene Names SSC1
Alternative Protein Names Aquaporin-9 (AQP-9) (Aquaglyceroporin-9) (Small solute channel 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 295
Molecular Weight(Da) 31431
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Background
Function FUNCTION: Forms a water channel with a broad specificity. Also permeable glycerol and urea. Mediates passage of a wide variety of small, non-charged solutes including carbamides, polyols, purines, and pyrimidines. {ECO:0000269|PubMed:10564231, ECO:0000269|PubMed:30420639, ECO:0000269|PubMed:9514918}.
Pathway
Protein Families MIP/aquaporin (TC 1.A.8) family
Tissue Specificity Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen. {ECO:0000269|PubMed:10564231, ECO:0000269|PubMed:9514918}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8600565

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human AQP9 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.