Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens alpha hemoglobin stabilizing protein (AHSP), transcript variant 1 (NM_016633). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NZD4 |
| Entry Name | AHSP_HUMAN |
| Gene Names | AHSP EDRF ERAF |
| Alternative Gene Names | EDRF ERAF |
| Alternative Protein Names | Alpha-hemoglobin-stabilizing protein (Erythroid differentiation-related factor) (Erythroid-associated factor) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 102 |
| Molecular Weight(Da) | 11840 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS |
Background
| Function | FUNCTION: Acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development. Specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. {ECO:0000269|PubMed:12066189}. |
| Pathway | |
| Protein Families | AHSP family |
| Tissue Specificity | Expressed in blood and bone marrow. {ECO:0000269|PubMed:11231637, ECO:0000269|PubMed:12066189}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |