Recombinant Human ACTR3C protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens ARP3 actin-related protein 3 homolog C (ACTR3C), transcript variant 1 (NM_001164458).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9C0K3
Entry Name ARP3C_HUMAN
Gene Names ACTR3C ARP11
Alternative Gene Names ARP11
Alternative Protein Names Actin-related protein 3C (Actin-related protein 11)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 210
Molecular Weight(Da) 23712
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKMEQIPLSYPQGHGFHPLSPPFH
Background
Function FUNCTION: May play a role in the suppression of metastatic potential in lung adenoma carcinoma cells. {ECO:0000269|PubMed:11162478}.
Pathway
Protein Families Actin family
Tissue Specificity Expressed in kidney, stomach, spleen, bone marrow, uterus, testis, placenta, skeletal muscle, mammary gland, lung, fetal liver, and fetal kidney, but not detected in small intestine, brain, and thymus. Expressed in low-metastatic lung adenocarcinoma cells but not in high-metastatic ones. {ECO:0000269|PubMed:11162478}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8811196

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human ACTR3C protein
Copyright © 2021-present Echo Biosystems. All rights reserved.