Recombinant Human 39S ribosomal protein L54, mitochondrial(MRPL54)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q6P161
Gene Names MRPL54
Alternative Names 39S ribosomal protein L54; 39S ribosomal protein L54 mitochondrial; 39S ribosomal protein L54 mitochondrial precursor ; L54mt; mitochondrial; mitochondrial ribosomal protein L54 ; MRP L54 ; MRP-L54; MRPL54; RM54_HUMAN
Expression Region Full Length of Mature Protein(15-138aa )
Molecular Weight 18.2 kDa
Protein Sequence GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance
Involvement in Disease
Subcellular Location Mitochondrion
Protein Families
Tissue Specificity MRPL54
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE1HU14996

Recombinant Human 39S ribosomal protein L54, mitochondrial(MRPL54)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human 39S ribosomal protein L54, mitochondrial(MRPL54)
Copyright © 2021-present Echo Biosystems. All rights reserved.